PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009115786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 366aa    MW: 37866.6 Da    PI: 7.7664
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009115786.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702227.91.9e-701382874152
          DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaesk 97 
                     +++sCqdCGnqakkdCah RCRtCCksrgf+C thv+stWvpaakrrerqqql + + ++   + ++  +kr re+  +++s+l +t+++++++ 
  XP_009115786.1 138 TGVSCQDCGNQAKKDCAHVRCRTCCKSRGFQCPTHVRSTWVPAAKRRERQQQLGTVQPQTHLPRgDSGVPKRLRENLPATSSSLVCTRVPTHHNA 232
                     4679*************************************************999877766665788999************************ PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152
                     + le+ ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGhvfkGiLyd+G+
  XP_009115786.1 233 SGLEVGDFPAEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHVFKGILYDNGP 287
                     ******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.0E-64139287IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.7E-26141183IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-27240287IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MAGFFSLDGG GGRGGGGNGQ EEHRTNTNPP PPVSDSWLWY RNPNVNANAN ANANAPSSSN  60
AAALGTLELW QNHNQQEIMF QHQQHQQRLD LYSSAAGLGV GPSSHSQFNI SGETSNAGAG  120
GTAAAALMMM RSGGGGGTGV SCQDCGNQAK KDCAHVRCRT CCKSRGFQCP THVRSTWVPA  180
AKRRERQQQL GTVQPQTHLP RGDSGVPKRL RENLPATSSS LVCTRVPTHH NASGLEVGDF  240
PAEVSSPAVF RCVRVSSVED GEEEFAYQTA VSIGGHVFKG ILYDNGPGSI GGGGYNVGES  300
SSGGGGAQQM NLITAGSVTV ATASSSTPNA GGIGGSSAAY TDPAALYPTP INTFMAGTQF  360
FPNPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11016GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.301380.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052630.0GU205263.1 Brassica rapa subsp. pekinensis stylish 1-2 (STY1-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115786.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLD2KC720.0D2KC72_BRARP; Stylish 1-2
STRINGBra038880.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-152Lateral root primordium (LRP) protein-related